 |
PalmPred An SVM Based Method for Palmitoylated Peptide Prediction |
|
|
|
PalmPred identifies palmitoylated cysteine residues in a protein sequence. Therefore users are requested to submit the protein sequence with at least one cysteine residue. The example of input sequence is given below:
>Q9UP65 MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG SALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL A
PalmPred users have a choise to select probability score for False Positive Rate (FPR). The performance of PalmPred at different FPR is described under the section 'ABOUT'.
- Understanding PalmPred Result
The PalmPred will provide you result as follows.
|
- NOTE
Users are requested to restrict the protein name up to a maximum of 6 characters. Users intersted in prediction of cys-palmitoyl region for a large number of proteins are encouraged to download standalone of Palmpred instead of using PalmPred web-server.
|